Bacillus toyonensis: Btoyo_1087 Help Entry Btoyo_1087        CDS       T02901                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bty  Bacillus toyonensis Pathway bty00998   Biosynthesis of various antibiotics bty01100   Metabolic pathways bty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bty00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Btoyo_1087    00074 Mycolic acid biosynthesis     Btoyo_1087   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Btoyo_1087 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AHA07094 LinkDB All DBs Position complement(1084431..1084664) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgtgtaacaaaaatcatcgttgatcgtttaggtgtagaagaa actgaagtagtaccagctgcaagctttaaagaagatttaggcgcagactccctagatgta gtagaacttgtaatgcaattagaagatgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system