Bacillus toyonensis: Btoyo_2153
Help
Entry
Btoyo_2153 CDS
T02901
Name
(GenBank) Superoxide dismutase [Cu-Zn] precursor
KO
K04565
superoxide dismutase, Cu-Zn family [EC:
1.15.1.1
]
Organism
bty
Bacillus toyonensis
Pathway
bty04146
Peroxisome
Brite
KEGG Orthology (KO) [BR:
bty00001
]
09140 Cellular Processes
09141 Transport and catabolism
04146 Peroxisome
Btoyo_2153
Enzymes [BR:
bty01000
]
1. Oxidoreductases
1.15 Acting on superoxide as acceptor
1.15.1 Acting on superoxide as acceptor (only sub-subclass identified to date)
1.15.1.1 superoxide dismutase
Btoyo_2153
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sod_Cu
Motif
Other DBs
NCBI-ProteinID:
AHA08130
LinkDB
All DBs
Position
complement(2081294..2081833)
Genome browser
AA seq
179 aa
AA seq
DB search
MKKRLFFSCCLLFLMAGCDQGKPKEIEVKLHNASGDEVGTAKVVQQTSGVKITIKGEGFA
PGPHGIHVHEIGECKAPRFESSGNHFNPDNKKHGLLNPKGAENGDLPNVIADGSGKIKAD
IDAPHITLEEGKTTIHRKDGASIIITENPDDGMTQPTGKSGDRIACGVIVKKASDMKKK
NT seq
540 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaacggctttttttcagttgttgtttattatttctgatggcaggttgtgaccaa
ggaaagccgaaagaaattgaagtgaaattacataatgcttcaggagatgaagtagggact
gcgaaagtagttcagcaaacaagtggagtgaaaattacgattaaaggggaaggtttcgcg
cctggtccgcacggcatacatgtacatgaaattggagagtgtaaagcgcctcgttttgaa
tcgtctggtaatcattttaatccagataataaaaagcatggcttactcaatccgaagggt
gcggaaaatggtgatttaccgaatgtaattgcagatggttctggaaagattaaagcggat
atcgatgcaccgcacataacgcttgaagaagggaaaacgacgattcatagaaaagatgga
gcgtctattattattactgaaaaccctgatgatggcatgacacaaccaacgggtaaatct
ggtgatcgaattgcttgcggtgtgattgtaaaaaaagcgtcggatatgaagaaaaagtaa
DBGET
integrated database retrieval system