Burkholderia thailandensis H0587: BTL_1413 Help Entry BTL_1413          CDS       T03113                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism btz  Burkholderia thailandensis H0587 Pathway btz00998   Biosynthesis of various antibiotics btz01100   Metabolic pathways btz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTL_1413 (acpP)    00074 Mycolic acid biosynthesis     BTL_1413 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTL_1413 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AHI65998 LinkDB All DBs Position 1:1537576..1537815 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgagcaactgggcgtcgccgaa gctgaaatcaagaacgaagcgtcgttcgtgaatgacctcggcgcggactcgctcgacacg gtcgagctcgtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaagcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system