Burkholderia thailandensis H0587: BTL_4319 Help Entry BTL_4319          CDS       T03113                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism btz  Burkholderia thailandensis H0587 Brite KEGG Orthology (KO) [BR:btz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btz03036]     BTL_4319    03400 DNA repair and recombination proteins [BR:btz03400]     BTL_4319 Chromosome and associated proteins [BR:btz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTL_4319 DNA repair and recombination proteins [BR:btz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTL_4319 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AHI66841 LinkDB All DBs Position 2:complement(1150483..1150743) Genome browser AA seq 86 aa AA seqDB search MDDLKQQAKTARAVELPEVIVGLRKKIVEYGLTQKDLFPPRLGRPKKVDALPRPRYRDPD TGATWTGRGRAPAWIAGQDRERFLID NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgatttgaagcagcaggcgaagaccgcgcgcgcggtcgagttgcccgaggtgatc gtcgggctgcgcaagaagatcgtcgagtacggtctcacgcaaaaagacctgttcccgcct cgtctcggccggccgaagaaggtcgacgcgctgccgaggccgcgctatcgcgatccggac acgggggcgacatggacggggcgcggccgcgcacccgcatggatcgccgggcaggaccgc gagcggttcctgatcgattag

DBGET integrated database retrieval system