Burkholderia thailandensis H0587: BTL_477 Help Entry BTL_477           CDS       T03113                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism btz  Burkholderia thailandensis H0587 Brite KEGG Orthology (KO) [BR:btz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btz03036]     BTL_477    03400 DNA repair and recombination proteins [BR:btz03400]     BTL_477 Chromosome and associated proteins [BR:btz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTL_477 DNA repair and recombination proteins [BR:btz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTL_477 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS ROS_MUCR Rootletin Motif Other DBs NCBI-ProteinID:  AHI65579 LinkDB All DBs Position 1:528938..529234 Genome browser AA seq 98 aa AA seqDB search MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQDLGFAERARRGRPPK KGPLPPKYRDPKSGSTWSGRGKPPQWIVGKNRDRFLIG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaaatcaaggcgcagatcgtcgagcttcaggcccaggccgaagag gtgcgtcgtcaggagatcgcggccgtggtcgccgagctgcaaggcaagatcgccgagtac gggctcacggcgcaagacctgggatttgccgagcgcgcgcggcgcggccgtccgccgaag aaggggccgctgcccccgaagtaccgcgatccgaaatccggcagtacatggagcggccgc gggaaaccgccgcaatggatcgtcggcaaaaaccgcgatcgctttttgatcggctga

DBGET integrated database retrieval system