Burkholderia ubonensis: BW23_1475 Help Entry BW23_1475         CDS       T03794                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bub  Burkholderia ubonensis Brite KEGG Orthology (KO) [BR:bub00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bub03036]     BW23_1475    03400 DNA repair and recombination proteins [BR:bub03400]     BW23_1475 Chromosome and associated proteins [BR:bub03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BW23_1475 DNA repair and recombination proteins [BR:bub03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BW23_1475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE Motif Other DBs NCBI-ProteinID:  AJX17918 LinkDB All DBs Position I:complement(1579232..1579525) Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFTLAELGLSRAKAGKVGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNRDQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggaaaagctggagaagcaaatcgaagag gcgaagtcgcgtgaatacgccgaagtcctcaatgacgtgaagcagaaaatcgccgactac ggctttacgctcgccgagctcggcctgagccgtgcgaaggctggcaaggtcggccgtccg cgtgccggcgtcgcggcaaaataccgcgatccggaatcgggcgcgacgtggtcgggccgc ggcaagccgccgcgctggatcgccggcaagaaccgcgatcagtttgcaatctga

DBGET integrated database retrieval system