Burkholderia humptydooensis MSMB43: AQ610_23195 Help Entry AQ610_23195       CDS       T04266                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism bud  Burkholderia humptydooensis MSMB43 Brite KEGG Orthology (KO) [BR:bud00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bud03036]     AQ610_23195    03400 DNA repair and recombination proteins [BR:bud03400]     AQ610_23195 Chromosome and associated proteins [BR:bud03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AQ610_23195 DNA repair and recombination proteins [BR:bud03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AQ610_23195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  ALX45380 LinkDB All DBs Position 2:934023..934313 Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAEAARQAELQAAIDDVRAKVREYGLTAYDVFGHRKKPGERKRE AVRPKYRDPATGATWSGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggcccgggccgaggcgttgagcgcgcaggccgaagcg gcgcggcaggccgaattgcaggccgcgatcgacgacgtgcgcgcgaaggtgcgcgagtac ggtctgacggcatacgacgtgttcggacaccgaaagaaaccgggcgagcgcaagcgcgag gcggtcaggccgaagtaccgcgatccggcgacgggtgcgacctggagcgggcgcggcatc gagccgaaatggattcgcggccgcaaccgggacgaattcctgatcgagtga

DBGET integrated database retrieval system