Buttiauxella sp. 3AFRM03: D8682_07010 Help Entry D8682_07010       CDS       T05676                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism buf  Buttiauxella sp. 3AFRM03 Pathway buf01100   Metabolic pathways buf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:buf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D8682_07010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D8682_07010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AYN26755 UniProt:  A0A3G2IC28 LinkDB All DBs Position complement(1149191..1149463) Genome browser AA seq 90 aa AA seqDB search MESLETDIKQLIIDTLNLEEISVDEIESEAALFGNDGLGLDSIDALELGLAVKKRYGVVL SAENEAMREHFYSVANLAAFIKSQNPAHSA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaatccttagagaccgatattaaacaactcattatcgatactttgaatctcgaagag ataagcgttgatgagattgaaagtgaggccgcgttatttggtaatgacggccttggcctt gattccattgacgcactggaattaggactggcggttaaaaaacgttatggtgtggtgtta tccgccgaaaacgaagcgatgcgcgaacatttttattctgtcgcgaatctcgccgcattt attaaaagtcaaaaccctgcgcacagcgcctga

DBGET integrated database retrieval system