Burkholderia sp. PAMC 28687: AX768_27375 Help Entry AX768_27375       CDS       T05699                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism bui  Burkholderia sp. PAMC 28687 Brite KEGG Orthology (KO) [BR:bui00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bui03036]     AX768_27375    03400 DNA repair and recombination proteins [BR:bui03400]     AX768_27375 Chromosome and associated proteins [BR:bui03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AX768_27375 DNA repair and recombination proteins [BR:bui03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AX768_27375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AMM17870 LinkDB All DBs Position 3:986286..986600 Genome browser AA seq 104 aa AA seqDB search MDERKRDSIIAYLRSRMAEFGISETALAEALAEAQASVTPPPLTKSSSATKRALPSMPQM PENANGATPVFRNASGDTWDGEGEMPEWLKRAVHAGQDIEFYRV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt gtggacgaaagaaagcgagacagcatcattgcctatttgcgcagccgaatggctgagttt ggcatttccgaaacagcactggccgaagcattggccgaagcgcaggcttctgttactcct cccccattgacgaagagttcgagcgccacaaagcgcgcgctaccttccatgcctcaaatg cctgagaacgccaacggcgctacgccggtattcaggaatgcaagcggcgacacgtgggac ggagaaggtgaaatgccagagtggctcaaacgcgctgtgcatgccgggcaagatatagag ttctacagggtttga

DBGET integrated database retrieval system