Burkholderia sp. PAMC 28687: AX768_30290 Help Entry AX768_30290       CDS       T05699                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bui  Burkholderia sp. PAMC 28687 Pathway bui00998   Biosynthesis of various antibiotics bui01100   Metabolic pathways bui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AX768_30290    00074 Mycolic acid biosynthesis     AX768_30290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AX768_30290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMM18534 LinkDB All DBs Position p1:complement(128214..128468) Genome browser AA seq 84 aa AA seqDB search MVKDYKLDPALLKADASLETLGLDSLAVAELLFNVEDKFKITVSPELVPLATLGDVVRFI DAHIAAQHGSGPTQAASTLAPPSV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt ttggttaaggattacaaactcgacccggcgctgctcaaagctgacgcgtcgctggagacg ctgggtctcgactctctcgcggtcgcagaattgctatttaacgtagaagacaaattcaag atcaccgtatcaccggagctcgtaccgctggccacgcttggggacgtcgttcgcttcatc gacgcgcatatcgctgcccagcatggcagcggaccgacgcaggcggcgtcaacactggca ccaccgtcagtatga

DBGET integrated database retrieval system