Stenotrophomonas maltophilia JV3: BurJV3_3969 Help Entry BurJV3_3969       CDS       T01596                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism buj  Stenotrophomonas maltophilia JV3 Pathway buj01100   Metabolic pathways buj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:buj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BurJV3_3969    00074 Mycolic acid biosynthesis     BurJV3_3969   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BurJV3_3969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEM53281 LinkDB All DBs Position complement(4390744..4391001) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac atcacgccggaggacatcgatccgaccgcgccgctgttcgtcgagggcctcggcctggat tcgatcgacgcgctggagctgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system