Burkholderia sp. KJ006: MYA_0206 Help Entry MYA_0206          CDS       T02110                                  Name (GenBank) DNA-binding protein H-NS   KO K03746   DNA-binding protein H-NS Organism buk  Burkholderia sp. KJ006 Brite KEGG Orthology (KO) [BR:buk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:buk03036]     MYA_0206    03400 DNA repair and recombination proteins [BR:buk03400]     MYA_0206 Chromosome and associated proteins [BR:buk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MYA_0206 DNA repair and recombination proteins [BR:buk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       MYA_0206 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE Motif Other DBs NCBI-ProteinID:  AFJ84575 UniProt:  I2DIU9 LinkDB All DBs Position 1:230114..230407 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNRDQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctcgcccagcgggagaagctggagaagcaaatcgaagaa gcaaagtcgcgtgaatacgcggaagtgctgaatgacgtgaagcagaaaattgccgactac ggcttttcgctcgccgaactcggtctcagccgtgcgaaggcgggcaaggtcggccgtccg cgcgccggtgtggcagcaaagtaccgtgacccggaatcgggcgcgacgtggtcgggccgc ggcaagccgccgcgctggatcgccggcaagaaccgcgatcagttcgcgatttaa

DBGET integrated database retrieval system