Burkholderia sp. KJ006: MYA_5171 Help Entry MYA_5171          CDS       T02110                                  Name (GenBank) DNA-binding protein H-NS   KO K03746   DNA-binding protein H-NS Organism buk  Burkholderia sp. KJ006 Brite KEGG Orthology (KO) [BR:buk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:buk03036]     MYA_5171    03400 DNA repair and recombination proteins [BR:buk03400]     MYA_5171 Chromosome and associated proteins [BR:buk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MYA_5171 DNA repair and recombination proteins [BR:buk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       MYA_5171 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF3811 Histone_HNS_N Motif Other DBs NCBI-ProteinID:  AFJ89519 UniProt:  I2DXZ3 LinkDB All DBs Position 3:130893..131219 Genome browser AA seq 108 aa AA seqDB search MTHPTIRELQRQLGRLNLIVEEARQKEKQARLNEIAAHVREFGITEIELLRAAGFVKARK QKAPAKYYDPDTGRAWSGKGARPGWLAGKNLDDYLIRTTPQPWWPETP NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacccatccgaccatacgcgagctgcagcggcagctcggccgattgaacctgatcgtc gaagaggcgcggcagaaggagaagcaggcgcggctgaacgaaattgcggcgcacgtgcgc gagttcggcatcaccgaaatcgaactgctgcgtgcggccggtttcgtcaaggcgaggaag cagaaggcgccggcgaaatactacgatcccgacaccggccgcgcgtggtcgggcaagggc gcgcgccccggctggctggccggcaagaatctcgacgactacctgatcaggacgaccccg cagccgtggtggccggaaacgccttga

DBGET integrated database retrieval system