Burkholderia sp. 2002721687: BW21_1925 Help Entry BW21_1925         CDS       T03759                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bul  Burkholderia sp. 2002721687 Pathway bul00190   Oxidative phosphorylation bul01100   Metabolic pathways bul02020   Two-component system Module bul_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bul00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BW21_1925  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BW21_1925 Enzymes [BR:bul01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BW21_1925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB DUF4064 Motif Other DBs NCBI-ProteinID:  AJY43175 UniProt:  A0AAU8T2X0 LinkDB All DBs Position I:complement(2091477..2091740) Genome browser AA seq 87 aa AA seqDB search MIDVVHSSPAALAGGAPSNRPAARAAVLTVKETAMWYFSWILGIGVALGFGIINAMWLEA NGNFPTGAAGDAHDAHGPAAPPEDPRS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgatcgacgtcgtgcactcgtcgccggccgcgctcgcgggcggcgctccctcgaatcgc ccggcggcccgcgcggccgtcctgaccgtcaaggagacagcgatgtggtacttctcgtgg attctcggcatcggcgtcgcgctcggcttcggcatcatcaacgcgatgtggctcgaagcg aacggcaatttcccgacgggcgccgccggcgacgcgcatgacgcgcacgggcccgccgca ccgccggaggacccacgttcgtga

DBGET integrated database retrieval system