Burkholderia sp. 2002721687: BW21_6003 Help Entry BW21_6003         CDS       T03759                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bul  Burkholderia sp. 2002721687 Brite KEGG Orthology (KO) [BR:bul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bul03036]     BW21_6003    03400 DNA repair and recombination proteins [BR:bul03400]     BW21_6003 Chromosome and associated proteins [BR:bul03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BW21_6003 DNA repair and recombination proteins [BR:bul03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BW21_6003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  AJY38891 UniProt:  A0AAU8S9B6 LinkDB All DBs Position II:complement(2777426..2777716) Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAEAARQAELQAAIDDVRAKVREYGLTAYDVFGHRKKPGERKRE AVRPKYRDPATGATWSGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggcccgggccgaggcgttgagcgcgcaggccgaagcg gcgcggcaggccgaattgcaggccgcgatcgacgacgtgcgcgcgaaggtgcgcgagtac ggtctgacggcatacgacgtgttcggacaccgaaagaaaccgggcgagcgcaagcgcgag gcggtcaggccgaagtaccgcgatccggcgacgggtgcgacctggagcgggcgcggcatc gagccgaaatggattcgcggccgcaaccgggacgaattcctgatcgagtga

DBGET integrated database retrieval system