Burkholderia sp. PAMC 26561: AXG89_01055 Help Entry AXG89_01055       CDS       T05481                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bum  Burkholderia sp. PAMC 26561 Pathway bum00998   Biosynthesis of various antibiotics bum01100   Metabolic pathways bum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXG89_01055    00074 Mycolic acid biosynthesis     AXG89_01055   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXG89_01055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AME22625 UniProt:  A0A125SEW9 LinkDB All DBs Position 1:complement(213583..213822) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcttcgttcgtcaacgatctgggcgctgactcgctcgacacc gtcgaactcgtgatggctctcgaagacgaattcggcatggaaattccggacgaagaagca gaaaagatcacgacggttcagcaagcgatcgattacgctcgcgcgaacgtcaaggcttaa

DBGET integrated database retrieval system