Burkholderia sp. PAMC 26561: AXG89_12830 Help Entry AXG89_12830       CDS       T05481                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism bum  Burkholderia sp. PAMC 26561 Brite KEGG Orthology (KO) [BR:bum00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bum03032]     AXG89_12830    03036 Chromosome and associated proteins [BR:bum03036]     AXG89_12830    03400 DNA repair and recombination proteins [BR:bum03400]     AXG89_12830 DNA replication proteins [BR:bum03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AXG89_12830 Chromosome and associated proteins [BR:bum03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AXG89_12830 DNA repair and recombination proteins [BR:bum03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AXG89_12830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HYPK_UBA HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AME24607 UniProt:  A0A0X8L641 LinkDB All DBs Position 1:2803162..2803434 Genome browser AA seq 90 aa AA seqDB search MNKTELIDHIAQQADISKAAAGRALEAVIGGVKTTLEKGGSVTLVGFGTFAVGKRTARTG RNPRTGDAIKIKAAKVPKFRAGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacggaattgatcgaccatatcgcgcagcaggcggatatatcgaaggcagca gccggacgggcgctcgaagcggtgatcggcggcgtgaagactacgctggaaaagggcggt tcggtgacgcttgtgggcttcggaacgttcgcggtcggcaagcgcacggcacgcacgggc cgcaatccccgaacgggcgacgcgatcaagatcaaggccgcaaaggttcctaaatttcgg gctggcaaagcactaaaagatgcgctaaactag

DBGET integrated database retrieval system