Burkholderia sp. PAMC 26561: AXG89_17595 Help Entry AXG89_17595       CDS       T05481                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism bum  Burkholderia sp. PAMC 26561 Brite KEGG Orthology (KO) [BR:bum00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bum03036]     AXG89_17595    03400 DNA repair and recombination proteins [BR:bum03400]     AXG89_17595 Chromosome and associated proteins [BR:bum03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AXG89_17595 DNA repair and recombination proteins [BR:bum03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AXG89_17595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AME25771 UniProt:  A0A0X8L8B9 LinkDB All DBs Position 2:463321..463635 Genome browser AA seq 104 aa AA seqDB search MDERKRDSIIAYLRSRMAEFGISETALAEALAEAQASVTPPPLTKSSSATKRALPSMPQM PENANGATPVFRNASGDTWDGEGEMPEWLKRAVHAGQDIEFYRV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt gtggacgaaagaaagcgagacagcatcattgcctatttgcgcagccgaatggctgagttt ggcatttccgaaacagcactggccgaagcattggccgaagcgcaggcttctgttactcct cccccattgacgaagagttcgagcgccacaaagcgcgcgctaccttccatgcctcaaatg cctgagaacgccaacggcgctacgccggtattcaggaatgcaagcggcgacacgtgggac ggagaaggtgaaatgccagagtggctcaaacgcgccgtgcatgccgggcaagatatagag ttctacagggtttga

DBGET integrated database retrieval system