Bacteroides uniformis: Bun01g_26840 Help Entry Bun01g_26840      CDS       T06523                                  Name (GenBank) hypothetical protein   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism bun  Bacteroides uniformis Pathway bun00190   Oxidative phosphorylation bun01100   Metabolic pathways Module bun_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:bun00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Bun01g_26840  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:bun00194]     Bun01g_26840 Photosynthesis proteins [BR:bun00194]  Photosystem and electron transport system   F-type ATPase [OT]    Bun01g_26840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  BBK88314 UniProt:  A0A139K5W3 LinkDB All DBs Position 3387854..3388105 Genome browser AA seq 83 aa AA seqDB search MMKKLHLNIVSPEKELFNGEVESVTLPGTMGSFSILPQHAPIVSSLGTGKLIYATDGEEH ELDIQSGFVEMSNGRVAVCIEQQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgatgaaaaagttgcatttgaatattgtttcaccggagaaggaactcttcaacggggaa gtggaaagtgttacattgccgggcactatgggctctttttctatcctgccgcagcatgca ccgattgtatcatcgttgggaacggggaaattgatttacgcaacggacggtgaggaacat gagttggatattcaaagcggattcgtggagatgagtaacggaagggttgccgtctgtata gaacagcaatag

DBGET integrated database retrieval system