Bacteroides uniformis: Bun01g_34290 Help Entry Bun01g_34290      CDS       T06523                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism bun  Bacteroides uniformis Pathway bun03060   Protein export bun03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:bun00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Bun01g_34290  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Bun01g_34290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bun02044]     Bun01g_34290 Secretion system [BR:bun02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    Bun01g_34290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BBK89059 UniProt:  A0A412SUI4 LinkDB All DBs Position 4263795..4263992 Genome browser AA seq 65 aa AA seqDB search MIPLFIGGIGMQEVLLIALVVLLFFGGRKIPELMKGIGKGVRSFKEGMNGMEKEISPENT DKKEE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgataccattatttatcggaggcatcggtatgcaggaagtgctgctgattgcattagtc gtcctgctgttcttcggaggacgcaaaattcccgaactgatgaaaggcatcggcaaaggt gtccgttcattcaaggaaggtatgaacggcatggagaaagaaatcagtcccgaaaatacc gacaagaaagaggagtga

DBGET integrated database retrieval system