Caballeronia insecticola: BRPE64_DCDS06340 Help Entry BRPE64_DCDS06340  CDS       T02684                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism buo  Caballeronia insecticola Pathway buo00998   Biosynthesis of various antibiotics buo01100   Metabolic pathways buo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:buo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BRPE64_DCDS06340 (acpP)    00074 Mycolic acid biosynthesis     BRPE64_DCDS06340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BRPE64_DCDS06340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  BAN27570 UniProt:  R4X090 LinkDB All DBs Position p1:complement(662280..662537) Genome browser AA seq 85 aa AA seqDB search MTVTENEILERIRAIFKENFAIEPERVTPEAHLFEELDLDSIDAVDLAIKLQEMTGRRIK PEEFKSVRTVADVVTAVESLLVEQE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgtgaccgaaaacgagatccttgagcgcatccgcgcgatcttcaaagagaacttc gcaatcgagcccgagcgtgtgacgcccgaggcccatctgttcgaagaactcgatctggac agcatcgacgcagtcgatctcgccatcaagctgcaggagatgacgggccgacgcatcaag cccgaagagttcaagtcggtgcgcacggtcgcggacgtcgtgaccgccgtcgagtcgctg ctcgtcgaacaggaatga

DBGET integrated database retrieval system