Caballeronia insecticola: BRPE64_ECDS03110 Help Entry BRPE64_ECDS03110  CDS       T02684                                  Symbol trxA Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism buo  Caballeronia insecticola Brite KEGG Orthology (KO) [BR:buo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:buo03110]     BRPE64_ECDS03110 (trxA) Chaperones and folding catalysts [BR:buo03110]  Protein folding catalysts   Protein disulfide isomerase    BRPE64_ECDS03110 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 TraF HyaE OST3_OST6 Glrx-like Motif Other DBs NCBI-ProteinID:  BAO94193 UniProt:  A0A060PJU7 LinkDB All DBs Position p2:complement(295019..295234) Genome browser AA seq 71 aa AA seqDB search MIAPVLEEVSKDYGDRLQVAKINVDDNQSTPARFGVRGIPTLILFKNGGIAAQKVGALSK SQLMAFLDNNL NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgattgcgccggtactcgaggaagtttcgaaagactacggcgaccgcctgcaggtcgca aagatcaacgtcgacgacaatcaatcgaccccggcgaggttcggcgtgcgcggcatccct acgttgattcttttcaagaacggcggtatcgcagcacaaaaggtcggtgccttgtccaag tcgcaactgatggcgtttctagacaataacttgtga

DBGET integrated database retrieval system