Burkholderia sp. HB1: AC233_12880
Help
Entry
AC233_12880 CDS
T04094
Name
(GenBank) multidrug ABC transporter ATPase
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
buq
Burkholderia sp. HB1
Brite
KEGG Orthology (KO) [BR:
buq00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
buq02000
]
AC233_12880
Transporters [BR:
buq02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
AC233_12880
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
SMC_N
AAA_16
TsaE
DUF7670
AAA_21
ABC_ATPase
AAA_22
AAA_30
G-alpha
AAA_29
AAA_15
KAP_NTPase
MobB
AAA_18
DO-GTPase1
DUF5906
AAA_24
Motif
Other DBs
NCBI-ProteinID:
ALE55469
LinkDB
All DBs
Position
1:2991411..2993294
Genome browser
AA seq
627 aa
AA seq
DB search
MTGKKLDFRGQAFKDVLGFTFIHWAKQPWRIVVIAALVMLSAVADVLTPMFAGHLVDAIA
SGPAARGSAWHAAITAFCVLGALGLGATLLRQGMYFNIIKLTLKMMSEIAANAFHRVQRF
STDWHANSFAGSTVRKITRGMWALDLLNDTLLIALFPSLIMLVGATLLLGWRWPMMGAVV
GIGSLIYITVTVALSLGYVAPAARLANAWDTRMGGALADAVSCNGVVKAFGAEEREEVLL
ARVIGKWRERTRRTWIRGTINGGVQGAMLVAIQTAILGAALMLWLRGEASVGDITFALTM
FFMLQGYLRDVGMHIRNLQRSVNDMEELVSLERQPLGIEDRPGAGPIAIGKGEIRFEHVT
FHYGANATPLYRDFSVRIAPGERVGLVGHSGSGKTTFIKLIQRLYDVSEGRITIDGQDIA
QVRQASLRSQIAIVQQEPVLFHRSLAENIAYARPDASRADIERAARLANAHDFISALPGG
YDTLVGERGIKLSGGERQRVAIARAFLADARILILDEATSSLDSESEVLIQQAMERLMLG
RTTLVVAHRLSTVRALDRLLVLDKGKVIEEGSHETLIGLENGLYRRLFERQALELIKGLS
EPPVPVRQETARMRSSTTDDSSLLVGK
NT seq
1884 nt
NT seq
+upstream
nt +downstream
nt
atgaccggaaaaaaactcgactttcgcggacaagcctttaaggatgtcctcggcttcacc
ttcattcactgggcgaaacagccgtggcgcatcgtcgtcattgcggcgctcgtcatgctc
tcagcggtggcggacgtgctgacgccgatgttcgccggccacctcgtcgacgccatcgcg
tccggcccggccgcgcgcggcagcgcctggcacgcggccatcacggcgttttgcgtgctc
ggcgcgctcggcctcggcgcgaccttgctgcggcaaggcatgtacttcaacatcatcaag
ctgacgctgaagatgatgagcgagatcgccgccaacgcgtttcatcgcgtgcagcggttt
tcgaccgactggcatgcgaacagcttcgcgggctctaccgtgcgcaaaatcacgcgcggc
atgtgggcgctcgacctgctgaacgacacgctgctgatcgcactgtttccgtcgctgatc
atgctggttggcgcgacgctgctgctcggctggcgctggccgatgatgggcgcggtggtc
ggcatcggctcgctgatctacatcacggtaacggtcgcgctgtcgctcggctatgtcgcg
cccgccgcgcgcctcgcgaatgcgtgggacacgcgcatgggcggcgcgctcgcggacgcg
gtgagctgcaacggcgtggtcaaggccttcggcgcggaagagcgcgaggaagtactgctt
gcgcgcgtgatcggcaaatggcgcgaacgcacgcggcgcacgtggattcgcggcacgatc
aacggcggcgtgcagggcgcgatgctggtggcgatccagacggccatcctaggcgccgct
ctgatgctgtggctgcgcggcgaggcgagcgtcggcgacatcacgttcgcgctgacgatg
ttcttcatgctgcaaggctatttgcgcgacgtgggcatgcacattcgcaacttgcagcgc
tccgtcaacgacatggaagaactcgtgtcgctggagcgccagccgctcggtatcgaagat
cggccgggcgccggtccgatcgcaattggcaaaggcgagatccgcttcgagcacgtcacc
ttccactatggggcgaacgccacgccgctgtaccgcgacttctccgtgcgcattgcgcct
ggcgaacgcgtcgggctggtcggccattcgggctcgggcaagacgacctttatcaagctg
atccagcgcctttacgacgtttcggaaggccgcatcacgatcgacggtcaggacatcgcg
caggtcaggcaggcgtcgttgcgcagccagattgcgatcgtgcagcaggagccggtgctg
tttcatcgctcgctcgcggagaacatcgcctatgcgcgtccggacgcgagccgcgccgac
atcgagcgagccgcgcggcttgcgaacgcgcacgacttcatcagcgcgttgcccggcggt
tatgacacgctggtcggcgagcgcggcatcaagctgtcgggcggcgagcgtcagcgtgtg
gcaatcgcgcgcgcgtttctcgccgacgcccgcattctgattctcgacgaagcgacgtcg
agcctcgacagcgaaagcgaagtactgatccagcaggcgatggagcggctgatgctcggc
cgcacgacgctcgtggtcgcgcaccgcctgtcgaccgtgcgcgcactcgaccggttgctc
gtgctcgacaagggcaaggtgatcgaagaaggcagccacgaaacgctgatcggtctcgag
aacggcctgtaccggcggctcttcgagcggcaggcactggagttgatcaaaggcttgagc
gaaccgcccgtccccgtccgccaggaaacggcgcgcatgcgcagttcgacgactgacgat
tcgagcctgctggtcggcaagtaa
DBGET
integrated database retrieval system