Burkholderia sp. HB1: AC233_13780 Help Entry AC233_13780       CDS       T04094                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism buq  Burkholderia sp. HB1 Pathway buq00998   Biosynthesis of various antibiotics buq01100   Metabolic pathways buq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:buq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AC233_13780    00074 Mycolic acid biosynthesis     AC233_13780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AC233_13780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HalX Motif Other DBs NCBI-ProteinID:  ALE55622 LinkDB All DBs Position 1:complement(3184815..3185114) Genome browser AA seq 99 aa AA seqDB search MDSLKLEIKQLLIEALDLEDLSPADIDDDAPLFDTDGIGLDSIDALEIGIVLRKQYQLTI AANDDRTREHFRSISTLAALVASQREAAHAANETNSKGE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggattctttaaaactggaaattaagcagcttctgatcgaggcactcgatctggaagac ctgagccccgccgatatcgacgacgatgcaccgttgttcgataccgacggtatcggtctc gattcgatcgacgcactggaaatcggcatcgtgctgcgcaaacaatatcaattgaccatt gcggcaaacgacgaccgcacgcgcgagcactttcgctccatcagcacgctggccgcgctg gtggcaagtcagcgcgaagcggcgcacgccgcgaacgaaaccaacagcaaaggggaatga

DBGET integrated database retrieval system