Burkholderia sp. HB1: AC233_29430 Help Entry AC233_29430       CDS       T04094                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism buq  Burkholderia sp. HB1 Brite KEGG Orthology (KO) [BR:buq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:buq03032]     AC233_29430    03036 Chromosome and associated proteins [BR:buq03036]     AC233_29430    03400 DNA repair and recombination proteins [BR:buq03400]     AC233_29430 DNA replication proteins [BR:buq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AC233_29430 Chromosome and associated proteins [BR:buq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AC233_29430 DNA repair and recombination proteins [BR:buq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AC233_29430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  ALE58621 LinkDB All DBs Position 2:2093256..2093534 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAATGESKAATGQTIDAIVEAVTKAVVGGDTVQLVGFGSFSTGARAARVG RNPSTGAEIQIAAAKTVKFTAGKAFKEAVNAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgattgatgcagtcgccgcagcgacgggcgaaagcaaagcggcc acgggccaaaccatcgacgctatcgttgaagcggtgaccaaagccgtggtcggtggcgat acggtgcaactggtcggtttcggttctttctcgactggcgcgcgtgcagcacgcgtgggc cgcaatccgtcgacgggcgccgagatccagatcgccgcagccaagacggtgaagttcacc gcaggcaaggcgttcaaggaagcagtcaacgcgtcgtaa

DBGET integrated database retrieval system