Burkholderia lata: Bcep18194_A4236 Help Entry Bcep18194_A4236   CDS       T00286                                  Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism bur  Burkholderia lata Pathway bur00998   Biosynthesis of various antibiotics bur01100   Metabolic pathways bur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bcep18194_A4236    00074 Mycolic acid biosynthesis     Bcep18194_A4236   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bcep18194_A4236 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABB07833 UniProt:  Q39I83 A0A3G3H2L0 LinkDB All DBs Position 1:1171191..1171430 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgctgaacaactgggcgtcgcagaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacg gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system