Burkholderia lata: Bcep18194_A5014 Help Entry Bcep18194_A5014   CDS       T00286                                  Name (GenBank) Cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bur  Burkholderia lata Pathway bur00190   Oxidative phosphorylation bur01100   Metabolic pathways bur02020   Two-component system Module bur_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bur00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Bcep18194_A5014  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Bcep18194_A5014 Enzymes [BR:bur01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Bcep18194_A5014 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB B277 Motif Other DBs NCBI-ProteinID:  ABB08608 UniProt:  Q39G08 LinkDB All DBs Position 1:2050559..2050705 Genome browser AA seq 48 aa AA seqDB search MWYFSWILGIGVALGFGIINAMWLEAEVFSRGDKRNGASGPRPGGKAS NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcgtggatactcggcatcggcgtggcgctcggcttcggcatcatcaac gcgatgtggctggaagcggaagtcttctcgcgcggcgacaagcgcaacggcgcgtcgggc ccgcgcccgggaggcaaggcttcgtga

DBGET integrated database retrieval system