Burkholderia lata: Bcep18194_A6089 Help Entry Bcep18194_A6089   CDS       T00286                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bur  Burkholderia lata Pathway bur00998   Biosynthesis of various antibiotics bur01100   Metabolic pathways bur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bcep18194_A6089    00074 Mycolic acid biosynthesis     Bcep18194_A6089   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bcep18194_A6089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABB09683 UniProt:  Q39CY3 LinkDB All DBs Position 1:complement(3232238..3232501) Genome browser AA seq 87 aa AA seqDB search MMNALEQELATLIIGELNLEDVPLETVTAETPLYGEGFGLDSIDILEIALLISKKYGFEL RSDNPDNQKIFATLGALAAYVAGHRTK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgatgaacgcactggaacaagagctcgccacgctgatcatcggcgaactgaatctcgaa gacgtcccgctcgaaacagtgacggccgagaccccgctgtatggcgagggtttcgggctc gactccatcgacatcctggaaatcgccctgctgatctcgaagaaatacggcttcgagctg cgttcggacaatccggacaaccagaagatttttgcgacgctcggtgcactggctgcgtac gtcgccgggcaccgcacgaagtga

DBGET integrated database retrieval system