Burkholderia sp. FERM BP-3421: Bsp3421_000325 Help Entry Bsp3421_000325    CDS       T11127                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism burf  Burkholderia sp. FERM BP-3421 Brite KEGG Orthology (KO) [BR:burf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:burf03036]     Bsp3421_000325    03400 DNA repair and recombination proteins [BR:burf03400]     Bsp3421_000325 Chromosome and associated proteins [BR:burf03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Bsp3421_000325 DNA repair and recombination proteins [BR:burf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Bsp3421_000325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WDD90479 LinkDB All DBs Position p1:complement(91139..91372) Genome browser AA seq 77 aa AA seqDB search MSEVKAQIEALEIEAQELQAAEIAAVIADVRAKVFVDERSTVGRVPWDQVREVRGAEEMP VHNVGPLARQPTLATLL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt ttgtcagaggtgaaggcgcagattgaagcgctggaaattgaggcccaggagttgcaggct gcggaaattgcggcggtgatcgcagacgtgcgcgcgaaggtattcgttgatgagcgttcc accgtcggccgtgtgccatgggatcaggtccgcgaggttcgcggtgctgaggaaatgcca gtgcacaatgtcggcccactggccaggcaaccaacgctagcgacgcttctctag

DBGET integrated database retrieval system