Burkholderia sp. FERM BP-3421: Bsp3421_001465 Help Entry Bsp3421_001465    CDS       T11127                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism burf  Burkholderia sp. FERM BP-3421 Pathway burf00998   Biosynthesis of various antibiotics burf01100   Metabolic pathways burf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:burf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bsp3421_001465    00074 Mycolic acid biosynthesis     Bsp3421_001465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bsp3421_001465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WDD91537 LinkDB All DBs Position 2:complement(959602..959844) Genome browser AA seq 80 aa AA seqDB search MDMETIRAELATLLEVPVGELTDDAPLHQFGNWDSLAMVALIAYLVSGGQPSVNVDRLEK LATVGEIRALLAPACAEAAR NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggacatggaaacgatccgcgcggagcttgccaccctgctcgaagtgccggtcggggaa ttgaccgacgacgcgccgctgcatcagttcggcaactgggattcgctggcgatggtggcg ctgatcgcctacctcgtcagcggcggccagccctcggtgaacgtcgaccggctggagaag ctcgcgacggtcggcgagatccgcgcgctgctcgcgcccgcctgcgcggaagccgcgcga tga

DBGET integrated database retrieval system