Burkholderia sp. JP2-270: DM992_03595 Help Entry DM992_03595       CDS       T07766                                  Name (GenBank) DNA-binding protein HU-alpha   KO K03530   DNA-binding protein HU-beta Organism burk  Burkholderia sp. JP2-270 Brite KEGG Orthology (KO) [BR:burk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:burk03032]     DM992_03595    03036 Chromosome and associated proteins [BR:burk03036]     DM992_03595    03400 DNA repair and recombination proteins [BR:burk03400]     DM992_03595 DNA replication proteins [BR:burk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DM992_03595 Chromosome and associated proteins [BR:burk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DM992_03595 DNA repair and recombination proteins [BR:burk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DM992_03595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AWU98746 UniProt:  A0A2U9SJ96 LinkDB All DBs Position 1:761091..761369 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtcatcaagaaggccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagctttggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagaccggtgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system