Burkholderia sp. JP2-270: DM992_15975 Help Entry DM992_15975       CDS       T07766                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism burk  Burkholderia sp. JP2-270 Pathway burk00998   Biosynthesis of various antibiotics burk01100   Metabolic pathways burk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:burk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM992_15975    00074 Mycolic acid biosynthesis     DM992_15975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM992_15975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AWV00842 LinkDB All DBs Position 1:complement(3393755..3393994) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgctgaacaactgggcgtcgcggaa gcagagatcaagaacgaagcttcgttcgtgaacgatctgggcgccgactcgctcgacacg gtcgaactggtgatggctctcgaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system