Burkholderia sp. JP2-270: DM992_31325 Help Entry DM992_31325       CDS       T07766                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism burk  Burkholderia sp. JP2-270 Pathway burk00362   Benzoate degradation burk00621   Dioxin degradation burk00622   Xylene degradation burk01100   Metabolic pathways burk01120   Microbial metabolism in diverse environments burk01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:burk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     DM992_31325    00622 Xylene degradation     DM992_31325    00621 Dioxin degradation     DM992_31325 Enzymes [BR:burk01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      DM992_31325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AWV03693 UniProt:  A0A2U9SUD7 LinkDB All DBs Position 2:complement(2914345..2914533) Genome browser AA seq 62 aa AA seqDB search MPTFNIQLFEGRTVEQKREFVEAITRVTCETLGCAPGSVDIILTDVKKENWATAGKLWSD EG NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgccgactttcaacatccagctgttcgaaggccgcaccgtcgaacagaagcgcgaattc gtcgaagcaatcacgcgcgtcacgtgcgagacgctcggctgcgcgccgggctcggtcgac atcatcctgaccgacgtgaagaaggagaactgggcgacggccgggaagctgtggagcgac gagggctaa

DBGET integrated database retrieval system