Burkholderia sp. JP2-270: DM992_35955 Help Entry DM992_35955       CDS       T07766                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism burk  Burkholderia sp. JP2-270 Brite KEGG Orthology (KO) [BR:burk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:burk03036]     DM992_35955    03400 DNA repair and recombination proteins [BR:burk03400]     DM992_35955 Chromosome and associated proteins [BR:burk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM992_35955 DNA repair and recombination proteins [BR:burk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM992_35955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AWV04731 UniProt:  A0A2U9SXC7 LinkDB All DBs Position 3:complement(716062..716355) Genome browser AA seq 97 aa AA seqDB search MATYQELKAKADALLVQAEEARQAELATVLEEVRARIQEYGLTPEQVFGRKRVRSANGSQ PATPKYQDPKTGKTWSGRGREPSWIKGKKRDRFLIAE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggccacctatcaagagttgaaagccaaggctgatgcactgctcgtgcaagcggaagaa gctcggcaggccgaactagcgaccgtgctcgaggaagttcgcgcgcgtattcaagagtat ggtctcacgccggaacaggtcttcggccgtaagcgcgtacgcagcgcgaatggcagccaa cccgcgacgccaaagtatcaggatccgaaaacgggcaagacgtggagcgggcgtggccgc gaaccgtcatggatcaagggtaagaaacgtgatcgcttcttgatcgccgaatga

DBGET integrated database retrieval system