Burkholderia sp. JP2-270: DM992_39435 Help Entry DM992_39435       CDS       T07766                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism burk  Burkholderia sp. JP2-270 Brite KEGG Orthology (KO) [BR:burk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:burk03036]     DM992_39435    03400 DNA repair and recombination proteins [BR:burk03400]     DM992_39435 Chromosome and associated proteins [BR:burk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM992_39435 DNA repair and recombination proteins [BR:burk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM992_39435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  AWV05406 UniProt:  A0A2U9SYH7 LinkDB All DBs Position p2:31740..32036 Genome browser AA seq 98 aa AA seqDB search MATYLELKAQAEALAQQAEAARIAELESIITTIREQIAEYGITAEQLFGRRRAPASGTRT PVAPKYRDPKTGATWSGRGKAPHWIANAKNRDRFLIEQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggctacctatctcgaactgaaagctcaagcagaagcgctggcgcagcaagcggaagca gcgcggattgccgagctggaaagcatcatcacaacgattcgtgaacagatcgctgagtat ggcatcacggcagagcaacttttcggacgacggcgcgcgcctgcgtcgggcacgcgtacg ccggtcgcgccgaagtatcgcgatccgaaaacgggtgcgacctggagtgggcgtggcaag gctcctcactggattgcaaacgcgaagaaccgcgaccggtttttgatcgagcagtga

DBGET integrated database retrieval system