Burkholderia sp. MS389: GJG85_01315 Help Entry GJG85_01315       CDS       T10544                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism burm  Burkholderia sp. MS389 Brite KEGG Orthology (KO) [BR:burm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:burm03036]     GJG85_01315    03400 DNA repair and recombination proteins [BR:burm03400]     GJG85_01315 Chromosome and associated proteins [BR:burm03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     GJG85_01315 DNA repair and recombination proteins [BR:burm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       GJG85_01315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE YL1_C Motif Other DBs NCBI-ProteinID:  QRR12114 LinkDB All DBs Position 1:295056..295349 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcgaagtcgcgtgaatacgctgaagtgctgaatgacgtgaagcagaaaattgccgactac ggcttttcgctcgccgaactcggcctcagccgcgcgaaggccggcaaggtcggtcgtccg cgcgcaggcgtggcggccaagtatcgcgatccggaaacgggcgcgacgtggtcgggtcgt ggcaagccgccgcgctggatcgccggcaagaaccgcgaacagtttgcgatttaa

DBGET integrated database retrieval system