KEGG   Burkholderia sp. MS389: GJG85_07545
Entry
GJG85_07545       CDS       T10544                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
burm  Burkholderia sp. MS389
Brite
KEGG Orthology (KO) [BR:burm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:burm03016]
    GJG85_07545 (truB)
Enzymes [BR:burm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     GJG85_07545 (truB)
Transfer RNA biogenesis [BR:burm03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    GJG85_07545 (truB)
 Prokaryotic type
    GJG85_07545 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C
Other DBs
NCBI-ProteinID: QRR13265
LinkDB
Position
1:1614470..1615402
AA seq 310 aa
MTNAAPQRPRVPRRVLDGVLLLDKPVGLSSNDALIRAKRLLLAKKAGHTGTLDPLASGLL
PLCFGEATKFSQDLLDADKTYEATMRLGQRTATGDAEGDVIDTRPVECDRAAVEAALVRF
TGDIVQVPPMYSALKRDGKPLYEYARAGQTVERKGRNVTIHLLELLACELPDVTFRVTCS
KGTYVRTLAEDIGEALGCGAHLTMLRRTGVGALTLEHAVTLDALSDAAESARDAWLQPVD
ALLSTFPLVRLDEASAKRFLHGQRLPLSALEPIDAGEGERVRVYDATRLLGVARKANGVL
APERLVVTAE
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacgaatgcagcaccccaacgtccgcgcgtgccccggcgcgtgctggacggcgttctc
ctgctggacaagccggtcggcctgtccagcaacgatgcgctgattcgcgcgaagcgcctg
cttctcgcgaagaaggccggtcacaccggcacgctcgatccgctggcttcgggcctgctg
ccgttgtgtttcggcgaagcgaccaagttttcgcaggatttgctcgacgccgacaagacc
tatgaagcgacgatgcgtctcggccagcgcacggccaccggcgacgcggaaggcgacgtg
atcgacacgcggccggtcgaatgcgatcgagcggcggtggaagccgcgctcgtgcgcttc
accggcgacatcgtgcaggtgccgccgatgtattcggcgctcaagcgcgacggcaagccg
ctgtatgaatatgcgcgcgccggtcagaccgtcgagcggaaaggccgcaacgtgacgatc
cacttgctcgaactactcgcgtgcgagctgcccgacgtgacgtttcgcgtgacctgcagc
aagggcacgtatgtgcgcacgctggcggaggatatcggcgaagcgctgggttgcggcgcg
catttgacgatgctgcgtcgcacgggcgtcggtgcgctgacgctcgagcatgcggtgacg
ctcgacgcgctgtcggacgcggccgaatcggcgcgcgatgcatggctgcagccggttgat
gcgctgctgtcgacgtttccgctggtgcgtctcgacgaagccagcgcgaagcggtttctg
cacgggcagcggctaccgctgtcggcgctcgaaccgatcgacgcgggcgagggcgagcgc
gtgcgcgtgtacgacgcaacgcggttgctcggcgtggcgcgcaaggcgaatggcgtgctc
gcgccggagcggctggtcgtgacggctgagtga

DBGET integrated database retrieval system