Burkholderia sp. THE68: BTHE68_26710 Help Entry BTHE68_26710      CDS       T10528                                  Symbol soxD Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism burt  Burkholderia sp. THE68 Pathway burt00260   Glycine, serine and threonine metabolism burt01100   Metabolic pathways Module burt_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:burt00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     BTHE68_26710 (soxD) Enzymes [BR:burt01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      BTHE68_26710 (soxD)     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      BTHE68_26710 (soxD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  BBU28937 LinkDB All DBs Position 2:32072..32371 Genome browser AA seq 99 aa AA seqDB search MLLIECPWCGPRAETEFSCGGEADIARPLDTEKLTDREWGDYLFMRKNPRGVHREQWNHA QGCRRWFKVQRDTVSYEIQGYETFDRPLAVMSDNGGTSK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgttgctgatcgaatgcccctggtgcgggccgcgcgccgaaaccgaattctcctgcggc ggcgaagcggatatcgcgcgcccgctcgacaccgaaaaactcactgaccgcgaatggggc gactacctcttcatgcgcaagaatccgcgcggcgtgcatcgcgagcaatggaaccatgcg caaggctgccgccgctggttcaaggtgcagcgcgataccgtcagttatgaaatccagggc tacgagacgttcgaccgtccgttggctgtcatgtccgacaacggaggcacgtcgaaatga

DBGET integrated database retrieval system