Burkholderia sp. THE68: BTHE68_57780 Help Entry BTHE68_57780      CDS       T10528                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism burt  Burkholderia sp. THE68 Pathway burt00998   Biosynthesis of various antibiotics burt01100   Metabolic pathways burt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:burt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTHE68_57780    00074 Mycolic acid biosynthesis     BTHE68_57780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTHE68_57780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBU32044 LinkDB All DBs Position BTHE68_p1:complement(93959..94219) Genome browser AA seq 86 aa AA seqDB search MNELERELAELIVTELNLEDVDPKAVSADTRLYEEGFGLDSIDILEIALLISKKYGFELR SDNPDNQKIFANLGALAAHVAAHRTR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgaactggaaagagagctcgcggagctgatcgtcaccgaattgaacctcgaggac gtcgatcccaaggccgtctcggccgacacgcggttgtatgaagaaggattcgggctcgat tccatcgacatcctggagatcgcgcttctgatctcgaagaaatacggcttcgagctgcgc tcggacaatccggacaatcagaagatcttcgcgaacctcggcgcgctcgcggcgcacgtc gccgcgcaccgcacgcgataa

DBGET integrated database retrieval system