Burkholderia pseudomallei TSV202: X994_2852 Help Entry X994_2852         CDS       T03428                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism but  Burkholderia pseudomallei TSV202 Brite KEGG Orthology (KO) [BR:but00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:but03036]     X994_2852    03400 DNA repair and recombination proteins [BR:but03400]     X994_2852 Chromosome and associated proteins [BR:but03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     X994_2852 DNA repair and recombination proteins [BR:but03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       X994_2852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Topoisom_I_N Motif Other DBs NCBI-ProteinID:  AIV79406 UniProt:  A0A069BC08 LinkDB All DBs Position 1:3298346..3298639 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgctcagcgagagaagctggagaagcagatcgaagaa gccaagtcgcgcgaatacgcggaggtattgagcgacgtcaagcaaaagatcgccgattac ggtttcacgctcgcggaactcggtctcggtcgtggcaaagctggaaaagcggggcgaccc cgcgctggcgtcgcggcgaaataccgcgatccggaatccggcgcaacctggtcgggccgc gggaagcctcctcgctggatcgccggcaagaatcgcgaacaattcgcgatctga

DBGET integrated database retrieval system