Burkholderia pseudomallei TSV202: X994_4925 Help Entry X994_4925         CDS       T03428                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism but  Burkholderia pseudomallei TSV202 Brite KEGG Orthology (KO) [BR:but00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:but03036]     X994_4925    03400 DNA repair and recombination proteins [BR:but03400]     X994_4925 Chromosome and associated proteins [BR:but03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     X994_4925 DNA repair and recombination proteins [BR:but03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       X994_4925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF8104 HalX Frankia_peptide DUF4337 Motif Other DBs NCBI-ProteinID:  AIV74597 UniProt:  A0A069BIJ6 LinkDB All DBs Position 2:1494577..1494867 Genome browser AA seq 96 aa AA seqDB search MATYRQLTAQLEKLQQKIDKEREKAITDAIADIKAKIEEYDITPEELGFRSVKAAAKPKR ALPPKYLNPKTGETWSGRGRAPAWLGKNRNRFLIKD NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacctataggcaactgaccgcacagctcgaaaaacttcagcagaaaatcgacaag gaacgcgaaaaggcgatcacggacgcgattgccgatatcaaggcgaagatcgaggaatac gacatcacgccggaagagttggggttcagaagcgtcaaggcggcggcgaagccgaagcgc gcgctgccgccgaagtacctcaatccgaagacgggcgagacctggagcggccgcggccgc gcgccggcgtggctcggcaagaatcgcaaccgtttcctgatcaaggactga

DBGET integrated database retrieval system