Burkholderia pseudomallei TSV202: X994_5587 Help Entry X994_5587         CDS       T03428                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism but  Burkholderia pseudomallei TSV202 Brite KEGG Orthology (KO) [BR:but00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:but03036]     X994_5587    03400 DNA repair and recombination proteins [BR:but03400]     X994_5587 Chromosome and associated proteins [BR:but03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     X994_5587 DNA repair and recombination proteins [BR:but03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       X994_5587 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIV76136 LinkDB All DBs Position 2:2327058..2327348 Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAKAARQAELQAAIEDVRAKVREYGLTAYDVFGHRKKPGERHRG AVRPKYRDPATGATWTGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggctcgggccgaggcgctgagcgcgcaggccaaagcg gcgcggcaggctgaattgcaggccgcgatcgaagacgtgcgcgcgaaggtgcgcgagtac ggtctcacggcgtacgacgtgttcggacaccgaaagaagccgggcgagcgccatcgcggg gcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggaccggacgcggcatc gagccgaaatggatccggggccgcaatcgggacgaattcctgatcgaatga

DBGET integrated database retrieval system