Burkholderia mayonis: WS70_01165 Help Entry WS70_01165        CDS       T06044                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism buu  Burkholderia mayonis Brite KEGG Orthology (KO) [BR:buu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:buu03036]     WS70_01165    03400 DNA repair and recombination proteins [BR:buu03400]     WS70_01165 Chromosome and associated proteins [BR:buu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     WS70_01165 DNA repair and recombination proteins [BR:buu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       WS70_01165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Topoisom_I_N Motif Other DBs NCBI-ProteinID:  AOJ00597 UniProt:  A0A1B4FA93 LinkDB All DBs Position 1:258943..259236 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKVGKAGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgctcagcgagagaagctggagaagcagatcgaagag gccaagtcgcgcgaatacgcggaggtattgagcgacgtcaagcaaaagatcgccgattac ggtttcacgctcgcagaactcggtctcggtcgtggcaaagtcggaaaggcgggtcgtccc cgcgccggcgtcgcggcgaaataccgcgacccggaatccggcgcgacatggtcgggccgt gggaagcctcctcgctggatcgccggcaagaatcgcgagcaattcgcaatctga

DBGET integrated database retrieval system