Burkholderia mayonis: WS70_18245 Help Entry WS70_18245        CDS       T06044                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism buu  Burkholderia mayonis Brite KEGG Orthology (KO) [BR:buu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:buu03036]     WS70_18245    03400 DNA repair and recombination proteins [BR:buu03400]     WS70_18245 Chromosome and associated proteins [BR:buu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     WS70_18245 DNA repair and recombination proteins [BR:buu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       WS70_18245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS FIMAH HalX DUF7553 Motif Other DBs NCBI-ProteinID:  AOJ03857 UniProt:  A0A1B4FJK2 LinkDB All DBs Position 2:250030..250320 Genome browser AA seq 96 aa AA seqDB search MATYRQLTAQLEKLQQKIDKEREKAIADAIADIKAKIEEYDITPDELGFRSIKTTAKPKR PLPPKYLNPKTGETWSGRGRAPAWLGKNRNRFLIKD NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacctataggcaactgactgcacagctcgaaaaacttcaacagaaaatcgacaag gaacgcgaaaaagcgatcgcggacgccattgccgatatcaaggcgaagatcgaagaatac gacatcacaccggacgaattgggattcaggagtatcaagacgacggcgaagccgaagcgc ccgctgccgccgaagtacctcaatccgaagacgggcgagacctggagcggccgcggccgt gctccggcttggctcggcaagaatcgcaaccgcttcctgatcaaggactga

DBGET integrated database retrieval system