Burkholderia mayonis: WS70_24640 Help Entry WS70_24640        CDS       T06044                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism buu  Burkholderia mayonis Pathway buu00260   Glycine, serine and threonine metabolism buu01100   Metabolic pathways Module buu_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:buu00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     WS70_24640 Enzymes [BR:buu01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      WS70_24640     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      WS70_24640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  AOJ04938 UniProt:  A0A1B4FMP8 LinkDB All DBs Position 2:complement(1818016..1818324) Genome browser AA seq 102 aa AA seqDB search MLLIECPWCGPRAESEFSCGGEADIARPLDTDTLSDREWGDYLFMRKNPRGAHREQWLHT QGCRRWFMAQRDTVTYEIQGYDTFGGAADGKPAATAAEDTSK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgttgctgatcgaatgtccgtggtgcggtccgcgcgccgaatccgaattcagctgcggc ggcgaagccgacatcgcgcgcccgctcgatacggacacgctgtccgaccgcgaatggggc gattacctgttcatgcgcaagaacccgcgcggcgcgcatcgcgagcaatggctgcacacg cagggctgccgccgctggttcatggcgcagcgcgataccgtcacttacgaaatccagggc tacgacacgttcggcggtgccgccgacggcaagccggccgccaccgcagcagaggacacg agcaaatga

DBGET integrated database retrieval system