Butyricimonas faecalis: D8S85_20650 Help Entry D8S85_20650       CDS       T05785                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism buy  Butyricimonas faecalis Brite KEGG Orthology (KO) [BR:buy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:buy03032]     D8S85_20650    03036 Chromosome and associated proteins [BR:buy03036]     D8S85_20650    03400 DNA repair and recombination proteins [BR:buy03400]     D8S85_20650 DNA replication proteins [BR:buy03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     D8S85_20650 Chromosome and associated proteins [BR:buy03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     D8S85_20650 DNA repair and recombination proteins [BR:buy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       D8S85_20650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AZS31719 UniProt:  A0A3S9VYU9 LinkDB All DBs Position 4791894..4792181 Genome browser AA seq 95 aa AA seqDB search MDKRKIVRIVAQRNGMSQRDVAMVFDEIFRVMLEGLKEEGHVGVSGFGSFNVKKCAVRHR YVLSTQKVVLYPESRKVTFKVAKQFKLWVDGVIKE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggacaagagaaaaatagttagaattgtagcccaaagaaatggtatgtcacaaagagat gtggcaatggtattcgatgaaatcttcagagtgatgttagaaggattgaaagaagaaggg catgtgggcgtgtcgggctttggatctttcaacgtgaagaaatgtgctgttcggcatcga tatgtgctttcaacccaaaaagttgttttatatccggaaagcagaaaagttacttttaaa gttgctaaacaatttaagctttgggtggatggagtgatcaaagagtga

DBGET integrated database retrieval system