Paraburkholderia phytofirmans OLGA172: AYM40_10245 Help Entry AYM40_10245       CDS       T05111                                  Name (GenBank) ATP F0F1 synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism buz  Paraburkholderia phytofirmans OLGA172 Pathway buz00190   Oxidative phosphorylation buz01100   Metabolic pathways Module buz_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:buz00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AYM40_10245  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:buz00194]     AYM40_10245 Photosynthesis proteins [BR:buz00194]  Photosystem and electron transport system   F-type ATPase [OT]    AYM40_10245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C SseC Motif Other DBs NCBI-ProteinID:  ANB72705 UniProt:  A0A160FK37 LinkDB All DBs Position 1:complement(2365924..2366172) Genome browser AA seq 82 aa AA seqDB search MNNLIEIVSIAAAALAVSFGAIGPALAEGRAVAAAMDAIARQPDSAGTVSRTLFVGLAMI ETMAIYCLVIALLLLFANPFVK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaataacctcattgaaatcgtcagcatcgccgccgcggcgctcgctgtatcgttcggc gcgatcggcccggcgcttgccgaaggccgcgccgtcgcagccgcgatggatgccatcgcg cggcagcccgactcggccggcaccgtgtctcgcacgctattcgtcgggcttgccatgatc gagacaatggcgatctattgcctcgtgatcgcattgctcctgctgtttgccaacccgttc gtgaaatag

DBGET integrated database retrieval system