Paraburkholderia phytofirmans OLGA172: AYM40_22500 Help Entry AYM40_22500       CDS       T05111                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism buz  Paraburkholderia phytofirmans OLGA172 Brite KEGG Orthology (KO) [BR:buz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:buz03032]     AYM40_22500    03036 Chromosome and associated proteins [BR:buz03036]     AYM40_22500    03400 DNA repair and recombination proteins [BR:buz03400]     AYM40_22500 DNA replication proteins [BR:buz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AYM40_22500 Chromosome and associated proteins [BR:buz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AYM40_22500 DNA repair and recombination proteins [BR:buz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AYM40_22500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Urease_beta Motif Other DBs NCBI-ProteinID:  ANB75187 UniProt:  A0A161HZA0 LinkDB All DBs Position 2:491421..491699 Genome browser AA seq 92 aa AA seqDB search MNKQELVDAVAAVTDESKVATGEMIDAVIATITGAVTKGDTVQLIGFGSFSTGARAARVG RNPATGAEIQIPAAKTVKFTAGKAFKDAVNAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggaactggtggatgcggtcgcggcggtaaccgatgaaagcaaggtcgcg accggcgagatgatcgacgcagtgatcgctacgatcaccggcgcggtgacgaagggcgac accgtccagctgattggcttcggctcgttttccacgggtgcgcgcgccgcacgggtcggc cgcaatccggcgaccggcgccgaaatccagatccccgcagcgaagacggtcaagttcacg gcgggcaaggcgttcaaggatgccgtcaacgcgtcatga

DBGET integrated database retrieval system