Paraburkholderia phytofirmans OLGA172: AYM40_33700 Help Entry AYM40_33700       CDS       T05111                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism buz  Paraburkholderia phytofirmans OLGA172 Brite KEGG Orthology (KO) [BR:buz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:buz03036]     AYM40_33700    03400 DNA repair and recombination proteins [BR:buz03400]     AYM40_33700 Chromosome and associated proteins [BR:buz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AYM40_33700 DNA repair and recombination proteins [BR:buz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AYM40_33700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Phage_CI_repr Histone_HNS_N DUF2299 Motif Other DBs NCBI-ProteinID:  ANB77670 UniProt:  A0A160FWA4 LinkDB All DBs Position 2:complement(3085950..3086213) Genome browser AA seq 87 aa AA seqDB search MKEREEQRLFDLDGNARERLIVWIRRRMDEYGISMEALADAIEADKAAVRAVMYRDAFGN TWDGHGDKPDWLARAIYAGQNIDHFRC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaagagcgagaagaacaacggctgttcgacctcgacgggaatgcgcgtgagcgcctg atcgtgtggatccgccgacgcatggacgaatacggcatttcgatggaagcgcttgccgat gcgatcgaggccgacaaagccgcagtccgggcagtgatgtatcgcgacgccttcggcaat acgtgggacggtcatggcgataagccagattggctcgcgcgcgcgatctacgctggacag aacatcgaccatttccgctgttga

DBGET integrated database retrieval system