Bombus vancouverensis nearcticus: 117153633 Help Entry 117153633         CDS       T07628                                  Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism bvan  Bombus vancouverensis nearcticus Pathway bvan04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:bvan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     117153633  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:bvan03016]     117153633    04121 Ubiquitin system [BR:bvan04121]     117153633 Transfer RNA biogenesis [BR:bvan03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     117153633 Ubiquitin system [BR:bvan04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    117153633 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  117153633 NCBI-ProteinID:  XP_033183739 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MSIESSSIPVIIEFGGGAELLFDKKKKHSVDLPGNEWTIQKLLFWIKDNLLKERPELFMQ GDTVRPGILVLVNDTDWELLGESNYNINSGDTILFISTLHGG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtctatcgaaagtagcagtattcccgtgatcattgaatttggaggtggggcagaatta cttttcgacaaaaagaaaaagcactctgtggacttacctggaaacgaatggactatacaa aagttacttttctggataaaagataaccttctaaaagaacgaccggaactttttatgcaa ggagacaccgtgcgaccaggaattttggtacttgtaaatgacaccgattgggaattattg ggcgagagcaattacaacataaactcaggcgacacgatattgtttatatccaccttacac ggaggatag

DBGET integrated database retrieval system